| Name | alpha Actinin 2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1068 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | alpha Actinin 2 Blocking Peptide |
| Description | Rabbit polyclonal alpha Actinin 2 antibody raised against the C terminal of ACTN2 |
| Gene | ACTN2 |
| Supplier Page | Shop |