| Name | DYNC1I1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4124 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP |
| Purity/Format | Affinity purified |
| Blocking Peptide | DYNC1I1 Blocking Peptide |
| Description | Rabbit polyclonal DYNC1I1 antibody raised against the N terminal of DYNC1I1 |
| Gene | DYNC1I1 |
| Supplier Page | Shop |