Anti-Glycophorin A antibody
| Name | Anti-Glycophorin A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128271 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 32-81 ( SSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERV ) of Human Glycophorin A (NP_002090) |
| Description | Rabbit Polyclonal |
| Gene | GYPA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Glycophorin A antibody (ab128271) at 1 µg/ml + Human fetal kidney lysate at 10 µg