Complexin 2 antibody

• Supplier: Fitzgerald
• Catalog: 70R-4500
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
• Purity/Format: Affinity purified
• Blocking Peptide: Complexin 2 Blocking Peptide
• Description: Rabbit polyclonal Complexin 2 antibody raised against the N terminal of CPLX2
• Gene: CPLX2