Anti-GTF2F1 antibody
| Name | Anti-GTF2F1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94651 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast |
| Antigen | Synthetic peptide, corresponding to a region within amino acids 36-85 ( KVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYG ) of Human GTF2F1 (NP_002087) |
| Description | Rabbit Polyclonal |
| Gene | GTF2F1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GTF2F1 antibody (ab94651) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution