Anti-RPS3 antibody

Name Anti-RPS3 antibody
Supplier Abcam
Catalog ab125372
Prices $376.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 191-240 ( PWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPV ) of Human RPS3 (P23396)
Description Rabbit Polyclonal
Gene RPS3
Conjugate Unconjugated
Supplier Page Shop

Product images