Anti-Secretory phospholipase A2 Type V antibody

• Supplier: Abcam
• Catalog: ab97848
• Prices: $370.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Rat, Horse, Guinea Pig, Bovine, Cat, Dog
• Antigen: Synthetic peptide corresponding to a region within internal amino acids 88 - 137 ( YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC ) of Human Secretory phospholipase A2 Type V (NP_000920)
• Description: Rabbit Polyclonal
• Gene: PLA2G5
• Conjugate: Unconjugated