NR1I3 / CAR antibody
| Name | NR1I3 / CAR antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341839 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of mouse NR1I3. Synthetic peptide located within the following region: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS. |
| Description | Rabbit Polyclonal |
| Gene | Nr1i3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-NR1I3 Antibody Titration: 5.0 ug/ml; Positive Control: SP2/0 cell lysate