GABA-B R1 Antibody

Name GABA-B R1 Antibody
Supplier Novus Biologicals
Catalog NBP2-14033
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIV MLNPANTRSISNMTSQEFVEKLTKRLKR
Purity/Format Immunogen affinity purified
Blocking Peptide GABA-B R1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GABBR1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.