TCIRG1 Antibody
| Name | TCIRG1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89333 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TCIRG1 Protein |
| Description | Rabbit Polyclonal |
| Gene | TCIRG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25586_TCIRG1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89333-img0007.jpg)
Immunocytochemistry/Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
![Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25587_TCIRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-89333-img0006.jpg)
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.