G6PC Antibody
| Name | G6PC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80533 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | G6PC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7032_G6PC-Antibody-Western-Blot-NBP1-80533-img0003.jpg)
![Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7033_G6PC-Antibody-Western-Blot-NBP1-80533-img0002.jpg)