Exportin-T Antibody
| Name | Exportin-T Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57176 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to XPOT(exportin, tRNA (nuclear export receptor for tRNAs)) The peptide sequence was selected from the middle region of XPOT. Peptide sequence TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | XPOT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Exportin-T Antibody [NBP1-57176] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19897_Exportin-T-Antibody-Western-Blot-NBP1-57176-img0002.jpg)
Western Blot: Exportin-T Antibody [NBP1-57176] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: Exportin-T Antibody [NBP1-57176] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic and nuclear; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19898_Exportin-T-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57176-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Exportin-T Antibody [NBP1-57176] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic and nuclear; Primary Antibody Concentration: 1:100