Complexin-2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57001
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CPLX2 (complexin 2) The peptide sequence was selected from the N terminal of CPLX2. Peptide sequence MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CPLX2
• Conjugate: Unconjugated