ACF Antibody
| Name | ACF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33412 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: REIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACF Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | A1CF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ACF Antibody [NBP2-33412] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7417_ACF%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33412-img0006.jpg)
Immunocytochemistry/Immunofluorescence: ACF Antibody [NBP2-33412] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7418_ACF-Antibody-Immunohistochemistry-Paraffin-NBP2-33412-img0002.jpg)
Immunohistochemistry-Paraffin: ACF Antibody [NBP2-33412] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.