G6PC Antibody
| Name | G6PC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31916 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | G6PC Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | G6PC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26470_G6PC-Antibody-Immunohistochemistry-Paraffin-NBP2-31916-img0007.jpg)
Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
![Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26471_G6PC-Antibody-Immunohistochemistry-Paraffin-NBP2-31916-img0006.jpg)
Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
![Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26472_G6PC%2520Antibody-Immunohistochemistry-Paraffin-NBP2-31916-img0008.jpg)
Immunohistochemistry-Paraffin: G6PC Antibody [NBP2-31916] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.