PPAP2A Antibody

Name PPAP2A Antibody
Supplier Novus Biologicals
Catalog NBP1-59011
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPAP2A(phosphatidic acid phosphatase type 2A) The peptide sequence was selected from the N terminal of PPAP2A. Peptide sequence QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PPAP2A
Conjugate Unconjugated
Supplier Page Shop

Product images