Cytochrome P450 2C19 Antibody

Name Cytochrome P450 2C19 Antibody
Supplier Novus Biologicals
Catalog NBP1-85488
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
Purity/Format Immunogen affinity purified
Blocking Peptide Cytochrome P450 2C19 Protein
Description Rabbit Polyclonal
Gene CYP2C19
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.