SERCA2 ATPase Antibody
| Name | SERCA2 ATPase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34147 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SERCA2 ATPase Protein |
| Description | Rabbit Polyclonal |
| Gene | ATP2A2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SERCA2 ATPase Antibody [NBP2-34147] - heart muscle](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28326_SERCA2-ATPase-Antibody-Immunohistochemistry-NBP2-34147-img0002.jpg)
Immunohistochemistry: SERCA2 ATPase Antibody [NBP2-34147] - heart muscle
![Immunohistochemistry: SERCA2 ATPase Antibody [NBP2-34147] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28327_SERCA2-ATPase-Antibody-Immunohistochemistry-NBP2-34147-img0001.jpg)
Immunohistochemistry: SERCA2 ATPase Antibody [NBP2-34147] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
![Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147] - urothelial cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28328_SERCA2%2520ATPase%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34147-img0003.jpg)
Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody [NBP2-34147] - urothelial cancer