15-Lipoxygenase 2 Antibody
| Name | 15-Lipoxygenase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55145 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ALOX15B(arachidonate 15-lipoxygenase, type B) The peptide sequence was selected from the N terminal of ALOX15B (NP_001034220), Peptide sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALOX15B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: 15-Lipoxygenase 2 Antibody [NBP1-55145] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7183_15-Lipoxygenase%25202%2520Antibody-Western%2520Blot-NBP1-55145-img0002.jpg)
Western Blot: 15-Lipoxygenase 2 Antibody [NBP1-55145] - HepG2 cell lysate, concentration 0.2-1 ug/ml.