| Name | PAP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70670 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PAP2D(phosphatidic acid phosphatase type 2) The peptide sequence was selected from the N terminal of PAP2D. Peptide sequence FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PPAP2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |