Asialoglycoprotein Receptor 2 Antibody

Name Asialoglycoprotein Receptor 2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54888
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASGR2 (asialoglycoprotein receptor 2) The peptide sequence was selected from the N terminal of ASGR2. Peptide sequence STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ASGR2
Conjugate Unconjugated
Supplier Page Shop

Product images