SLC22A3 Antibody

Name SLC22A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-80529
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the middle region of human Slc22a3. Peptide sequence TSSELSCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWML.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Slc22a3
Conjugate Unconjugated
Supplier Page Shop

Product images