| Name | UBE2S antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2798 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UBE2S antibody was raised using the N terminal of UBE2S corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBE2S Blocking Peptide |
| Description | Rabbit polyclonal UBE2S antibody raised against the N terminal of UBE2S |
| Gene | UBE2S |
| Supplier Page | Shop |