| Name | ALOX15 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5828 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALOX15 antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALOX15 Blocking Peptide |
| Description | Rabbit polyclonal ALOX15 antibody raised against the middle region of ALOX15 |
| Gene | ALOX15 |
| Supplier Page | Shop |