Recombinant Mus musculus (Mouse) NACHT, LRR and PYD domains-containing protein 3

Name Recombinant Mus musculus (Mouse) NACHT, LRR and PYD domains-containing protein 3
Supplier Cusabio
Catalog CSB-EP823181MO
Category Protein
Species Reactivities Mouse
Nature Recombinant
Source E.coli
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q8R4B8
Gene Nlrp3
Residue 1-153aa
Sequence MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR
Description Partial
Supplier Page Shop

Product images