Active human IL1 beta full length protein
| Name | Active human IL1 beta full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155616 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Lyophilized from 0.22µm filtered solution |
| Bioactivity | The bioactivity was determined by dose dependent stimulation of the proliferation of Mouse D10.G4.1 cells. The ED 50 <2pg/ml, corresponding to a specific activity of >5X10 8 unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01584 |
| Gene | IL1B |
| Residue | 117 to 269 |
| Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGE ESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFV FNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQF VSS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab155616 stained overnight with Coomassie Blue.