Active human RANTES full length protein

• Supplier: Abcam
• Catalog: ab192136
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by its ability to chemoattract Human blood monocytes using a concentration range of 1-10 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P13501
• Gene: CCL5
• Residue: 24 to 91
• Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVC ANPEKKWVREYINSLEMS