| Name | Active mouse FGF basic protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab200265 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA HPLC |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. ab200265 is >98% pure as determined by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. The ED 50 , as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is <0.1ng/ml, corresponding to a specific activity of of > 1×10 7 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 10 to 154 |
| Sequence | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |