Active mouse FGF2 full length protein
| Name | Active mouse FGF2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab129033 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The activity was determined by the stimulation of HUVE cells. The ED 50 for this effect is = 0.1ng/ml corresponding to a specific activity of = 1 x 10 7 units/mg. |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 11 to 154 |
| Sequence | ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNN YNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |
