Mouse EBI-3

• Supplier: ABBIOTEC
• Catalog: 600178
• Category: Protein
• Prices: $250.00
• Sizes: 10 µg
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli. Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.
• Purity: Purity > 90% as determined by analytical HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.
• Bioactivity: Assay data for mouse recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody.
• Gene: Ebi3
• Sequence: MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVAT QQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFV AERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRG ASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQV ESAPHKP
• Description: Epstein-Barr Virus Induced Gene-3 (EBI-3 or IL27-beta) is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. This cytokine can regulate T helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and has diverse effects on innate immune cells. It synergizes with IL-12 to trigger interferon-gamma production in naïve CD4 T-cells, and binds to the cytokine receptor WSX-1/TCCR. It also has antitumor and antiangiogenic activity by inducing the production of antiangiogenic chemokines. Recombinant Mouse EBI is a non-glycosylated polypeptide chain consisting of 207 amino acids with a MW of 22.9 kDa.