Recombinant Human CDC20

Name Recombinant Human CDC20
Supplier Creative Biomart
Catalog CDC20-27897TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q12834
Gene CDC20
Sequence MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
Description Recombinant fragment corresponding to amino acids 1-100 of Human Cdc20 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop