| Name | Recombinant Human EIF3E |
|---|---|
| Supplier | Creative Biomart |
| Catalog | EIF3E-26384TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P60228 |
| Gene | EIF3E |
| Sequence | RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
| Description | Recombinant fragment corresponding to amino acids 346-445 of Human eIF3e with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
| Supplier Page | Shop |