Active rat FGF2 full length protein
| Name | Active rat FGF2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab179499 |
| Category | Protein |
| Prices | $202.00, $1,200.00 |
| Sizes | 50 µg, 500 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The activity is determined by the dose-dependent proliferation of mouse 3T3 cells and is typically less than 1 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 9 to 154 |
| Sequence | MPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |
Product images
ab179499 induced proliferation of mouse NIH 3T3 cells.