Active human C5 protein fragment
| Name | Active human C5 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab167724 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | ab167724 is active based on enzyme release assay of myeloperoxidase. The ED 50 = 1.36 nM. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01031 |
| Gene | C5 |
| Residue | 679 to 751 |
| Sequence | LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAF TECCVVASQLRANISHKDMQLGR |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab167724 stained overnight with Coomassie Blue (6µg).