Active human Fas Ligand full length protein
| Name | Active human Fas Ligand full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157085 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 10 µg |
| Applications | WB ELISA FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >95% by SDS-PAGE . ab157085 is purified by Multi-Step Chromatography. |
| Bioactivity | ED 50 : 50ng/ml (A20 cells). Kills Jurkat cells at concentrations of >10ng/ml in the absence of a cross-linker. Cross-linking enhancer increases the activity of rhsFasL approx. 50-fold. Please note: Results using sFasL may differ from those obtained with agonistic antibodies. |
| Endotoxin | > 0.100 Eu/µg |
| SwissProt/Accession | P48023 |
| Gene | FASLG |
| Residue | 103 to 281 |
| Sequence | QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKG GLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKM MSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLY KL |
| Supplier Page | Shop |
Product images
Activity Assay analysis: Inhibition of ab157085-mediated lysis. Fas (human):Fc (Human) (rec.) exerts its inhibitory activity in a concentration range of 0.5-5µg/ml in the presence of the enhancer (1µg/ml).