Active human Fas Ligand protein fragment
| Name | Active human Fas Ligand protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168908 |
| Category | Protein |
| Prices | $588.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to induce apoptosis of Jurkat Human acute T cell leukemia cells. The ED 50 for this effect is typically 0.1-1.5 ng/ml in the presence of 10 µg/ml of a crosslinking antibody Mouse Anti poly-Histidine Monoclonal Antibody. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P48023 |
| Gene | FASLG |
| Residue | 134 to 281 |
| Sequence | PSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVI NETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYC TTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab168908 stained overnight with Coomassie Blue.