Active human FGF basic full length protein
| Name | Active human FGF basic full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155734 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 200 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. ab155734 was lyophilised from 0.22 µm filtered solution. |
| Bioactivity | Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts. The ED 50 for this effect is typically 0.02 - 0.1 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 143 to 288 |
| Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of 6µg reduced ab155734 stained overnight with Coomassie Blue.