| Name | Active human FGF basic full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab176058 |
| Category | Protein |
| Prices | $110.00, $342.00 |
| Sizes | 10 µg, 50 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >= 98 % by SDS-PAGE. |
| Bioactivity | The ED 50 determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.05 ng/ml, corresponding to a specific activity of ≥ 2 x 10 7 units/mg. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 143 to 288 |
| Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |