| Name | Active human FGF basic full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192160 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors, corresponding to a specific activity of ≥ 2.0 x 10 6 units/mg. |
| Endotoxin | 1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 143 to 288 |
| Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |